PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016651161.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 340aa    MW: 38609.6 Da    PI: 5.13
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016651161.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.36.2e-5361331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+kveg ++el evi+ +d+yk++Pw+Lp k  +   + ew+fF+ rd+ky++g+r+nratk+gyWkatgkd++v+
  XP_016651161.1   6 LPPGFRFHPTDEELVGYYLKRKVEGLEFEL-EVIPVIDLYKFDPWELPeKsFLPRCDMEWFFFCARDRKYPNGSRTNRATKAGYWKATGKDRKVV 99 
                     79****************************.99**************94333444677************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + +++++g +ktLvfy+grap g +tdW+mheyrl
  XP_016651161.1 100 C-QSTVTGYRKTLVFYRGRAPLGDRTDWIMHEYRL 133
                     *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-604156IPR003441NAC domain
PROSITE profilePS5100557.5686156IPR003441NAC domain
PfamPF023653.9E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDEELV GYYLKRKVEG LEFELEVIPV IDLYKFDPWE LPEKSFLPRC  60
DMEWFFFCAR DRKYPNGSRT NRATKAGYWK ATGKDRKVVC QSTVTGYRKT LVFYRGRAPL  120
GDRTDWIMHE YRLSDDLAQG PSGHQGVFAL CRVIKKNENA QKTNDSHGEP KAKRVGSASN  180
SGEDLSSTRI SNEPLNISDD LSSQASYQHN ESHYSSHVTS PYEVNPIAEF EPTSRETNPA  240
DFWVSPDFIL DSSKLQEAMP NYFPQYKSAM ASWQSYENTE SPYSSYSNFT GDVTMADNAN  300
QVADMSPFSG HTGYMGYYGN EEMQFEGFDQ PSSLRNPTPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-54516216171NAC domain-containing protein 19
4dul_A1e-54516216171NAC domain-containing protein 19
1ut7_B1e-54516216171NO APICAL MERISTEM PROTEIN
1ut7_A1e-54516216171NO APICAL MERISTEM PROTEIN
1ut4_B1e-54516216171NO APICAL MERISTEM PROTEIN
1ut4_A1e-54516216171NO APICAL MERISTEM PROTEIN
3swp_D1e-54516219174NAC domain-containing protein 19
3swp_C1e-54516219174NAC domain-containing protein 19
3swp_B1e-54516219174NAC domain-containing protein 19
3swp_A1e-54516219174NAC domain-containing protein 19
3swm_D1e-54516219174NAC domain-containing protein 19
3swm_C1e-54516219174NAC domain-containing protein 19
3swm_B1e-54516219174NAC domain-containing protein 19
3swm_A1e-54516219174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4309452e-44AM430945.2 Vitis vinifera contig VV78X241223.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238287.10.0PREDICTED: NAC domain-containing protein 72
SwissprotA4VCM03e-71NAC45_ARATH; NAC domain-containing protein 45
SwissprotQ9FFI54e-71NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM5WMJ80.0M5WMJ8_PRUPE; Uncharacterized protein
STRINGVIT_02s0012g01040.t011e-163(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.16e-99NAC domain containing protein 71